PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g027550.1
Common NameMTR_5g027550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 230aa    MW: 26561.9 Da    PI: 9.3449
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g027550.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-1676122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r  WT+ E++l++++vk++G g+Wk I+r++ k++t+ q+ s+ qky
  Medtr5g027550.1  76 RVHWTEGEHKLFLQGVKKHGRGRWKDISREFVKTKTPTQIASHAQKY 122
                      668*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3171127IPR017930Myb domain
SuperFamilySSF466894.38E-1772127IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1674125IPR006447Myb domain, plants
SMARTSM007172.4E-975125IPR001005SANT/Myb domain
PfamPF002493.5E-1376122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-1176122IPR009057Homeodomain-like
CDDcd001674.93E-1079123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEGRKVQQLP HHIDLNERTS IQDLPENSLD QQREKLDTVV EFGRAVAIPN SNDNNLGQAE  60
LVPEGSHEAK RGRKERVHWT EGEHKLFLQG VKKHGRGRWK DISREFVKTK TPTQIASHAQ  120
KYFVHHQTAK EIEKKKKRRS IHDITLNNND TIVTVPLEQQ EATHRIEKQH EIPPQDTATL  180
NNKDNDNDNL QQTQQMYQLA LLYPIGTALP DMNKLEKMRN LFNLLAKDL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133138KKKKRR
2134138KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141280.0CU914128.2 Medicago truncatula chromosome 5 clone mth2-84e4, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612666.21e-170MYB-like DNA-binding domain, shaqkyf class protein
TrEMBLG7K8841e-170G7K884_MEDTR; MYB-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1691138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.17e-21Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]